Structure of PDB 1n6j Chain B

Receptor sequence
>1n6jB (length=90) Species: 9606 (Homo sapiens) [Search protein sequence]
GRKKIQISRILDQRNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSA
NRLFQYASTDMDRVLLKYTEYSEPHESRTNTDILETLKRR
3D structure
PDB1n6j Sequence-specific recruitment of transcriptional co-repressor Cabin1 by myocyte enhancer factor-2
ChainB
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B G2 R3 K4 I6 K23 R24 K30 G1 R2 K3 I5 K22 R23 K29
BS02 dna B G2 R3 K5 K31 G1 R2 K4 K30
BS03 peptide B D63 L67 T70 Y72 S73 E74 S78 D62 L66 T69 Y71 S72 E73 S77
Gene Ontology
Molecular Function
GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0046983 protein dimerization activity
Biological Process
GO:0045944 positive regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1n6j, PDBe:1n6j, PDBj:1n6j
PDBsum1n6j
PubMed12700764
UniProtQ02080|MEF2B_HUMAN Myocyte-specific enhancer factor 2B (Gene Name=MEF2B)

[Back to BioLiP]