Structure of PDB 1n52 Chain B

Receptor sequence

>1n52B (length=148) Species: 9606 (Homo sapiens) [Search protein sequence]

LKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQ
IYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYINGTR
LDDRIIRTDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLA

3D structure

PDB

1n52 Structural basis of m7GpppG binding to the nuclear cap-binding protein complex.

Chain

Resolution

2.11 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GTG	B	Y20 Y43 F83 R112 D114 R123 R127 Q133 V134 Y138	Y15 Y38 F78 R107 D109 R118 R122 Q128 V129 Y133

Gene Ontology

	Molecular Function
GO:0000339	RNA cap binding
GO:0000340	RNA 7-methylguanosine cap binding
GO:0003676	nucleic acid binding
GO:0003677	DNA binding
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0005515	protein binding
GO:0017069	snRNA binding

	Biological Process
GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0000380	alternative mRNA splicing, via spliceosome
GO:0000398	mRNA splicing, via spliceosome
GO:0002191	cap-dependent translational initiation
GO:0006397	mRNA processing
GO:0006406	mRNA export from nucleus
GO:0006408	snRNA export from nucleus
GO:0006417	regulation of translation
GO:0006446	regulation of translational initiation
GO:0008334	histone mRNA metabolic process
GO:0008380	RNA splicing
GO:0016071	mRNA metabolic process
GO:0031047	regulatory ncRNA-mediated gene silencing
GO:0031053	primary miRNA processing
GO:0031124	mRNA 3'-end processing
GO:0031442	positive regulation of mRNA 3'-end processing
GO:0032968	positive regulation of transcription elongation by RNA polymerase II
GO:0035194	regulatory ncRNA-mediated post-transcriptional gene silencing
GO:0035195	miRNA-mediated post-transcriptional gene silencing
GO:0042789	mRNA transcription by RNA polymerase II
GO:0045292	mRNA cis splicing, via spliceosome
GO:0046833	positive regulation of RNA export from nucleus
GO:0051028	mRNA transport

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005846	nuclear cap binding complex
GO:0034518	RNA cap binding complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1n52, PDBe:1n52, PDBj:1n52
PDBsum	1n52
PubMed	12434151
UniProt	P52298\|NCBP2_HUMAN Nuclear cap-binding protein subunit 2 (Gene Name=NCBP2)

[Back to BioLiP]