Structure of PDB 1n4m Chain B

Receptor sequence

>1n4mB (length=338) Species: 9606 (Homo sapiens)

NTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEK
FAKAVGAGCVAIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLND
NIFHMSLLACALEVVMATYSRSTTDLSFPWILNVLNLKAFDFYKVIESFI
KAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKTREGKSTSL
SLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRD
RHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEE
EYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHI

3D structure

• PDB: 1n4m Structural basis for the recognition of the E2F transactivation domain by the retinoblastoma tumor suppressor
• Chain: B
• Resolution: 2.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	E464 R467 K475 D479 F482 K530 E533 S534 K537 E551 E554 H555 T645 L649 K652 K653 R656	E85 R88 K96 D100 F103 K144 E147 S148 K151 E165 E168 H169 T198 L202 K205 K206 R209
BS02	peptide	B	Y709 K713 V714 N716 Y756 N757 M761 K765 A772 S773 R775	Y262 K266 V267 N269 Y309 N310 M314 K318 A325 S326 R328

Gene Ontology

Biological Process

• GO:0006357 regulation of transcription by RNA polymerase II
• GO:0051726 regulation of cell cycle

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:1n4m, PDBe:1n4m, PDBj:1n4m
• PDBsum: 1n4m
• PubMed: 12502741
• UniProt: P06400|RB_HUMAN Retinoblastoma-associated protein (Gene Name=RB1)