Structure of PDB 1mxe Chain B

Receptor sequence

>1mxeB (length=144) Species: 7227 (Drosophila melanogaster) [Search protein sequence]

LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMIN
EVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAA
ELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTS

3D structure

PDB

1mxe Structure of the Complex of Calmodulin with the Target Sequence of Calmodulin-Dependent Protein Kinase I: Studies of the Kinase Activation Mechanism

Chain

Resolution

1.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	E11 E14 F19 M36 Q41 E47 M51 M71 K75 E84 I85 E87 A88 M109 E114 E119 E120 M124 E127 M144 M145 S147	E8 E11 F16 M33 Q38 E44 M48 M68 K72 E81 I82 E84 A85 M106 E111 E116 E117 M121 E124 M141 M142 S144
BS02	CA	B	D129 D131 D133 Q135 E140	D126 D128 D130 Q132 E137
BS03	CA	B	D56 D58 N60 T62 E67	D53 D55 N57 T59 E64
BS04	CA	B	D20 D22 D24 T26 E31	D17 D19 D21 T23 E28
BS05	CA	B	D93 D95 N97 F99 E104	D90 D92 N94 F96 E101

Gene Ontology

	Molecular Function
GO:0005509	calcium ion binding
GO:0005515	protein binding
GO:0016247	channel regulator activity
GO:0030234	enzyme regulator activity
GO:0031489	myosin V binding
GO:0032036	myosin heavy chain binding
GO:0046872	metal ion binding
GO:0070855	myosin VI head/neck binding

	Biological Process
GO:0007099	centriole replication
GO:0007605	sensory perception of sound
GO:0007608	sensory perception of smell
GO:0016056	G protein-coupled opsin signaling pathway
GO:0016059	negative regulation of opsin-mediated signaling pathway
GO:0016060	negative regulation of phospholipase C-activating phototransduction signaling pathway
GO:0030048	actin filament-based movement
GO:0042052	rhabdomere development
GO:0046716	muscle cell cellular homeostasis
GO:0048102	autophagic cell death
GO:0050911	detection of chemical stimulus involved in sensory perception of smell
GO:0051383	kinetochore organization
GO:0071361	cellular response to ethanol
GO:0072499	photoreceptor cell axon guidance

	Cellular Component
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005813	centrosome
GO:0005814	centriole
GO:0005819	spindle
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0005938	cell cortex
GO:0016028	rhabdomere
GO:0030496	midbody
GO:0031475	myosin V complex
GO:0031476	myosin VI complex
GO:0031477	myosin VII complex
GO:0072686	mitotic spindle
GO:0097431	mitotic spindle pole

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1mxe, PDBe:1mxe, PDBj:1mxe
PDBsum	1mxe
PubMed	12475216
UniProt	P62152\|CALM_DROME Calmodulin (Gene Name=Cam)

[Back to BioLiP]