Structure of PDB 1mu8 Chain B

Receptor sequence

>1mu8B (length=250) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKEGQPS
VLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGGP
FVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQFG

3D structure

• PDB: 1mu8 Metabolism-directed optimization of 3-aminopyrazinone acetamide thrombin inhibitors. Development of an orally bioavailable series containing P1 and P3 pyridines.
• Chain: B
• Resolution: 2.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H57 D102 E192 G193 D194 S195 G196
• Catalytic site (residue number reindexed from 1): H43 D99 E194 G195 D196 S197 G198
• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	E23 G25 M26 P28 W29 H119 P120 C122 Y134 K135 R137 N159 M201 K202 R206 W207	E8 G10 M11 P13 W14 H116 P117 C119 Y134 K135 R137 N156 M203 K204 R210 W211
BS02	peptide	B	F34 Q38 L40 T74 R75 Y76 K81 I82	F19 Q24 L26 T69 R70 Y71 K77 I78
BS03	CDB	B	H57 Y60A N98 A190 S195 V213 S214 W215 G216	H43 Y47 N95 A192 S197 V217 S218 W219 G220	MOAD: Ki=1nM PDBbind-CN: -logKd/Ki=9.00,Ki=1.0nM

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:1mu8, PDBe:1mu8, PDBj:1mu8
• PDBsum: 1mu8
• PubMed: 12570369
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)