Structure of PDB 1mnm Chain B

Receptor sequence
>1mnmB (length=81) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
RRKIEIKFIENKTRRHVTFSKRKHGIMKKAFELSVLTGTQVLLLVVSETG
LVYTFSTPKFEPIVTQQEGRNLIQACLNAPD
3D structure
PDB1mnm Crystal structure of the yeast MATalpha2/MCM1/DNA ternary complex.
ChainB
Resolution2.25 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B T35 K38 R39 K45 T18 K21 R22 K28
BS02 dna B R18 R19 K20 S37 K38 K40 K46 T66 Y70 R1 R2 K3 S20 K21 K23 K29 T49 Y53
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000987 cis-regulatory region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0046983 protein dimerization activity
Biological Process
GO:0045944 positive regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1mnm, PDBe:1mnm, PDBj:1mnm
PDBsum1mnm
PubMed9490409
UniProtP11746|MCM1_YEAST Pheromone receptor transcription factor (Gene Name=MCM1)

[Back to BioLiP]