Structure of PDB 1mms Chain B

Receptor sequence
>1mmsB (length=70) Species: 2336 (Thermotoga maritima) [Search protein sequence]
KTPPASFLLKKAAGIEKGSSEPKRKIVGKVTRKQIEEIAKTKMPDLNANS
LEAAMKIIEGTAKSMGIEVV
3D structure
PDB1mms A detailed view of a ribosomal active site: the structure of the L11-RNA complex.
ChainB
Resolution2.57 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B P74 A75 S76 K80 K87 G88 S89 S90 E91 P92 K93 R94 K112 D115 N117 A118 N119 K126 I127 G130 T131 S134 M135 P4 A5 S6 K10 K17 G18 S19 S20 E21 P22 K23 R24 K42 D45 N47 A48 N49 K56 I57 G60 T61 S64 M65
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1mms, PDBe:1mms, PDBj:1mms
PDBsum1mms
PubMed10338213
UniProtP29395|RL11_THEMA Large ribosomal subunit protein uL11 (Gene Name=rplK)

[Back to BioLiP]