Structure of PDB 1mji Chain B

Receptor sequence
>1mjiB (length=179) Species: 274 (Thermus thermophilus) [Search protein sequence]
DVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDARIL
EKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWIFL
EKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDALR
GMDIAVVTTAETDEEARALLELLGFPFRK
3D structure
PDB1mji Detailed analysis of RNA-protein interactions within the bacterial ribosomal protein L5/5S rRNA complex
ChainB
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B Q66 K67 A69 V70 R91 V92 T93 R95 R96 R98 Q63 K64 A66 V67 R88 V89 T90 R92 R93 R95
BS02 rna B K36 V38 N40 K74 S124 D126 R128 N132 L133 D156 K33 V35 N37 K71 S121 D123 R125 N129 L130 D153
BS03 MG B R128 N130 T161 A163 R125 N127 T158 A160
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1mji, PDBe:1mji, PDBj:1mji
PDBsum1mji
PubMed12515387
UniProtP41201|RL5_THETH Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]