Structure of PDB 1mdv Chain B

Receptor sequence
>1mdvB (length=100) Species: 882 (Nitratidesulfovibrio vulgaris str. Hildenborough) [Search protein sequence]
GLKMEATKQPVVLNHSTHKSVKCGDCHHPVNGKEDYRKCGTAGCHDSMDK
KDKSAKGYYHVMHDKNTKFKSCVGCHVEVAGADAAKKKDLTGCKKSKCHE
3D structure
PDB1mdv Key role of phenylalanine 20 in cytochrome c3: structure, stability, and function studies.
ChainB
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM B L9 M11 H22 H25 C30 C33 H34 Y43 K45 L2 M4 H15 H18 C23 C26 H27 Y36 K38
BS02 HEM B H35 C46 C51 H52 T74 K75 F76 H28 C39 C44 H45 T67 K68 F69
BS03 HEM B H25 C79 C82 H83 V86 K104 H18 C72 C75 H76 V79 K97
BS04 HEM B M11 Q16 V18 H70 C79 C100 C105 H106 M4 Q9 V11 H63 C72 C93 C98 H99
Gene Ontology
Molecular Function
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0009061 anaerobic respiration
Cellular Component
GO:0042597 periplasmic space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1mdv, PDBe:1mdv, PDBj:1mdv
PDBsum1mdv
PubMed9890880
UniProtP00131|CYC3_NITV2 Cytochrome c3 (Gene Name=DVU_3171)

[Back to BioLiP]