Structure of PDB 1ma7 Chain B

Receptor sequence

>1ma7B (length=317) Species: 10678 (Punavirus P1)

SDEVRKNLMDMFRDRQAFSEHTWKMLLSVCRSWAAWCKLNNRKWFPAEPE
DVRDYLLYLQARGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVMRR
IRKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRNLAFLGIAYN
TLLRIAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVTK
LVERWISVSGVADDPNNYLFCRVRKNGVAAPSATSQLSTRALEGIFEATH
RLIYGAKDDSGQRYLAWSGHSARVGAARDMARAGVSIPEIMQAGGWTNVN
IVMNYIRNGAMVRLLED

3D structure

• PDB: 1ma7 Modulation of the active complex assembly and turnover rate by protein-DNA interactions in Cre-LoxP recombination
• Chain: B
• Resolution: 2.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	K43 M44 S47 R50 R81 L83 A84 K86 T87 Q90 R118 A131 K132 Q156 R159 R173 K201 T202 R241 V242 K244 L256 S257 R259 R282 W315 T316 N317 I320 Y324	K24 M25 S28 R31 R62 L64 A65 K67 T68 Q71 R99 A112 K113 Q137 R140 R154 K182 T183 R222 V223 K225 L237 S238 R240 R263 W296 T297 N298 I301 Y305	PDBbind-CN: Kd=146nM
BS02	dna	B	F37 S38 H40 T41 M97 R100 R101 R106 R121 R173 I174 A175 K201 R243 K244 N245 R259 E262 R282 Y283 S287 G288 H289	F18 S19 H21 T22 M78 R81 R82 R87 R102 R154 I155 A156 K182 R224 K225 N226 R240 E243 R263 Y264 S268 G269 H270	PDBbind-CN: Kd=146nM

Gene Ontology

Molecular Function

• GO:0003677 DNA binding

Biological Process

• GO:0006310 DNA recombination
• GO:0015074 DNA integration

External links

• PDB: RCSB:1ma7, PDBe:1ma7, PDBj:1ma7
• PDBsum: 1ma7
• PubMed: 12779336
• UniProt: P06956|RECR_BPP1 Recombinase cre (Gene Name=cre)