Structure of PDB 1m76 Chain B

Receptor sequence

>1m76B (length=291) Species: 9606 (Homo sapiens) [Search protein sequence]

KIIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEES
LRKVAKKKFAENPKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVEN
LKVKNELFKRLDKFAAEHTIFASNTCSLQITSIANATTRQDRFAGLHFFN
PVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKHPVSCKDTPGFIVNRLL
VPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFI
VDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYK

3D structure

PDB

1m76 Biochemical characterization and crystal structure determination of human heart short chain L-3-hydroxyacyl-COA dehydrogenase provide insights into catalytic mechanism

Chain

Resolution

2.15 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	C137 H158 E170 N208
Catalytic site (residue number reindexed from 1)	C126 H147 E159 N197
Enzyme Commision number	1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CAA	B	K68 C137 H158 F160 N161 P162 P164 V165 M166 N208 P243 M244 L249 Y252	K57 C126 H147 F149 N150 P151 P153 V154 M155 N197 P232 M233 L238 Y241
BS02	NAD	B	G24 L25 M26 D45 Q46 A107 I108 E110 K115 N135 C137 H158 N161 V253 K293	G13 L14 M15 D34 Q35 A96 I97 E99 K104 N124 C126 H147 N150 V242 K282

Gene Ontology

	Molecular Function
GO:0003857	3-hydroxyacyl-CoA dehydrogenase activity
GO:0016491	oxidoreductase activity
GO:0016616	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0016740	transferase activity
GO:0042802	identical protein binding
GO:0070403	NAD+ binding

	Biological Process
GO:0006631	fatty acid metabolic process
GO:0006635	fatty acid beta-oxidation
GO:0007283	spermatogenesis
GO:0009410	response to xenobiotic stimulus
GO:0009725	response to hormone
GO:0014823	response to activity
GO:0030154	cell differentiation
GO:0032868	response to insulin
GO:0046676	negative regulation of insulin secretion
GO:0050796	regulation of insulin secretion
GO:0120162	positive regulation of cold-induced thermogenesis

	Cellular Component
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005759	mitochondrial matrix

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1m76, PDBe:1m76, PDBj:1m76
PDBsum	1m76
PubMed
UniProt	Q16836\|HCDH_HUMAN Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial (Gene Name=HADH)

[Back to BioLiP]