Structure of PDB 1m6x Chain B

Receptor sequence

>1m6xB (length=401) Species: 4932 (Saccharomyces cerevisiae)

SQFDILCKTPPKVLVRQFVERFERPSGEKIASCAAELTYLCWMITHNGTA
IKRATFMSYNTIISNSLSFDIVNKSLQFKYKTQKATILEASLKKLIPAWE
FTIIPYNGSDITDIVSSLQLQFESGNSHSKKMLKALLSEGESIWEITEKI
LNSFEYTSRFTKTKTLYQFLFLATFINCGRFSDIKNVDPKSFKLVQNKYL
GVIIQCLVTETKTSVSRHIYFFSARGRIDPLVYLDEFLRNSEPVLKRVNR
TGNSSSNKQEYQLLKDNLVRSYNKALKKNAPYPIFAIKNGPKSHIGRHLM
TSFLSMKGLTELTNVVGNWSDYTHQITAIPDHYFALVSRYYAYDPISKEM
IALKDETNPIEEWQHIEQLKGSAEGSIRYPAWNGIISQEVLDYLSSYINR
R

3D structure

• PDB: 1m6x Structural Plasticity of the Flp-Holliday Junction Complex
• Chain: B
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	S2 Q3 T62 S169 R170 T174 Y178 K223 N278 R281 S282 K285 K289 N300	S1 Q2 T61 S158 R159 T163 Y167 K212 N267 R270 S271 K274 K278 N289
BS02	dna	B	K223 T224 W330 S331	K212 T213 W319 S320
BS03	dna	B	W43 H47 K53 A55 T56 Y60 K82 N108 F192 S193 K223 R281 N284 K299 N300 K303 S304 H305	W42 H46 K52 A54 T55 Y59 K81 N107 F181 S182 K212 R270 N273 K288 N289 K292 S293 H294

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003690 double-stranded DNA binding
• GO:0003697 single-stranded DNA binding
• GO:0008301 DNA binding, bending
• GO:0009009 site-specific recombinase activity

Biological Process

• GO:0006310 DNA recombination
• GO:0015074 DNA integration
• GO:0042150 plasmid recombination

Cellular Component

• GO:0005575 cellular_component

External links

• PDB: RCSB:1m6x, PDBe:1m6x, PDBj:1m6x
• PDBsum: 1m6x
• PubMed: 12559911
• UniProt: P03870|FLP_YEAST Site-specific recombinase Flp (Gene Name=FLP1)