Structure of PDB 1m5a Chain B

Receptor sequence

>1m5aB (length=30) Species: 9823 (Sus scrofa)

FVNQHLCGSHLVEALYLVCGERGFFYTPKA

3D structure

• PDB: 1m5a The high-resolution structure of hexameric T6 cobalt insulin: A possible pathway for the T to R transition.
• Chain: B
• Resolution: 1.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	F1 N3 Q4 H5 L6 C7 L11 L15 V18 C19 R22 G23 F24 F25 Y26 T27 P28 K29	F1 N3 Q4 H5 L6 C7 L11 L15 V18 C19 R22 G23 F24 F25 Y26 T27 P28 K29

Gene Ontology

Molecular Function

• GO:0005179 hormone activity

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:1m5a, PDBe:1m5a, PDBj:1m5a
• PDBsum: 1m5a
• UniProt: P01315|INS_PIG Insulin (Gene Name=INS)