Structure of PDB 1m4g Chain B

Receptor sequence
>1m4gB (length=176) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence]
HTARLVHTADLDSETRQDIRQMVTGAFAGDFTETDWEHTLGGMHALIWHH
GAIIAHAAVIQRRLIYRGNALRCGYVEGVAVRADWRGQRLVSALLDAVEQ
VMRGAYQLGALSSSARARRLYASRGWLPWHGPTSVLAPTGPVRTPDDDGT
VFVLPIDISLDTSAELMCDWRAGDVW
3D structure
PDB1m4g Aminoglycoside 2'-N-acetyltransferase from Mycobacterium tuberculosis in complex with coenzyme A and aminoglycoside substrates.
ChainB
Resolution1.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.3.1.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 COA B F32 V84 A85 V86 R91 G92 R94 V96 S119 Y126 F27 V79 A80 V81 R86 G87 R89 V91 S114 Y121
BS02 RIO B F32 D35 F36 D40 E82 S117 D152 W181 F27 D30 F31 D35 E77 S112 D147 W176
BS03 PAP B S119 A120 R121 R123 S114 A115 R116 R118
Gene Ontology
Molecular Function
GO:0016746 acyltransferase activity
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups
GO:0034069 aminoglycoside N-acetyltransferase activity
GO:0047921 aminoglycoside 2'-N-acetyltransferase activity
Biological Process
GO:0030649 aminoglycoside antibiotic catabolic process
GO:0046677 response to antibiotic
Cellular Component
GO:0005886 plasma membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1m4g, PDBe:1m4g, PDBj:1m4g
PDBsum1m4g
PubMed12161746
UniProtP9WQG9|AAC2_MYCTU Aminoglycoside 2'-N-acetyltransferase (Gene Name=aac)

[Back to BioLiP]