Structure of PDB 1m1p Chain B

Receptor sequence
>1m1pB (length=89) Species: 70863 (Shewanella oneidensis) [Search protein sequence]
DQKLSDFHAEGGCESCHKDGTPSADGAFEFAQCQSCHGKLSEMDAVHKPH
DGNLVCADCHAVHDMNVGQKPTCESCHDDGRTSASVLKK
3D structure
PDB1m1p Crystal structures at atomic resolution reveal the novel concept of 'electron-harvesting' as a role for the small tetraheme cytochrome c
ChainB
Resolution1.55 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEC B H9 C15 C18 H19 P24 V64 H65 H8 C13 C16 H17 P22 V62 H63
BS02 HEC B P51 H52 L56 C75 C78 H79 R83 P49 H50 L54 C73 C76 H77 R81
BS03 HEC B L5 H9 Q34 C35 C38 H39 H62 V69 G70 L4 H8 Q32 C33 C36 H37 H60 V67 G68
BS04 HEC B H39 L42 H49 H52 C58 C61 H62 P73 L89 H37 L40 H47 H50 C56 C59 H60 P71 L87
Gene Ontology
Molecular Function
GO:0046872 metal ion binding
Cellular Component
GO:0042597 periplasmic space

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1m1p, PDBe:1m1p, PDBj:1m1p
PDBsum1m1p
PubMed12080059
UniProtQ8EDL6

[Back to BioLiP]