Structure of PDB 1m08 Chain B

Receptor sequence
>1m08B (length=131) Species: 316407 (Escherichia coli str. K-12 substr. W3110) [Search protein sequence]
MRNKPGKATGKGKPVNNKWLNNAGKDLGSPVPDRIANKLRDKEFKSFDDF
RKKFWEEVSKDPELSKQFSRNNNDRMKVGKAPKTRTQDVSGKRTSFELHH
EKPISQNGGVYDMDNISVVTPKRHIDIHRGK
3D structure
PDB1m08 The Crystal Structure of the Nuclease Domain of Colicin E7 Suggests a Mechanism for Binding to Double-stranded DNA by the H-N-H Endonucleases
ChainB
Resolution2.1 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) R447 R538 E542 H544 H545 H569 H573
Catalytic site (residue number reindexed from 1) R2 R93 E97 H99 H100 H124 H128
Enzyme Commision number 3.1.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN B H544 H569 H573 H99 H124 H128
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0005102 signaling receptor binding
Biological Process
GO:0009617 response to bacterium
GO:0019835 cytolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1m08, PDBe:1m08, PDBj:1m08
PDBsum1m08
PubMed12441102
UniProtQ47112|CEA7_ECOLX Colicin-E7 (Gene Name=colE7)

[Back to BioLiP]