Structure of PDB 1ltx Chain B

Receptor sequence

>1ltxB (length=318) Species: 10116 (Rattus norvegicus)

KDVTIKSDPDTLLLEKHADYIASYGSCMSEYLRMSGVYWGLTVMDLMGQL
HRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHV
INVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAIN
VEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSD
LLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKL
RSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVF
CMPEEVLQRVNVQPELVS

3D structure

• PDB: 1ltx Structure of Rab Escort Protein-1 in Complex with Rab Geranylgeranyltransferase
• Chain: B
• Resolution: 2.7 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H190 R232 K235 D238 C240 Y241 D280 D287 H290
• Catalytic site (residue number reindexed from 1): H177 R219 K222 D225 C227 Y228 D267 D274 H277
• Enzyme Commision number: 2.5.1.60: protein geranylgeranyltransferase type II.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	H190 Y241 D287 F289	H177 Y228 D274 F276
BS02	ZN	B	D238 C240 H290	D225 C227 H277
BS03	FAR	B	Y51 Q103 R144 Y195 W244	Y38 Q90 R131 Y182 W231

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004659 prenyltransferase activity
• GO:0004661 protein geranylgeranyltransferase activity
• GO:0004663 Rab geranylgeranyltransferase activity
• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0008318 protein prenyltransferase activity
• GO:0019840 isoprenoid binding
• GO:0031267 small GTPase binding
• GO:0046872 metal ion binding

Biological Process

• GO:0018344 protein geranylgeranylation

Cellular Component

• GO:0005968 Rab-protein geranylgeranyltransferase complex

External links

• PDB: RCSB:1ltx, PDBe:1ltx, PDBj:1ltx
• PDBsum: 1ltx
• PubMed: 12620235
• UniProt: Q08603|PGTB2_RAT Geranylgeranyl transferase type-2 subunit beta (Gene Name=Rabggtb)