Structure of PDB 1lrh Chain B

Receptor sequence
>1lrhB (length=160) Species: 4577 (Zea mays) [Search protein sequence]
SCVRDNSLVRDISQMPQSSYGIEGLSHITVAGALNHGMKEVEVWLQTISP
GQRTPIHRHSCEEVFTVLKGKGTLLMGSSSLKYPGQPQEIPFFQNTTFSI
PVNDPHQVWNSDEHEDLQVLVIISRPPAKIFLYDDWSMPHTAAVLKFPFV
WDEDCFEAAK
3D structure
PDB1lrh Crystal structure of auxin-binding protein 1 in complex with auxin.
ChainB
Resolution1.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MAN B G24 L25 G24 L25
BS02 MAN B Q17 S18 S19 S26 Q17 S18 S19 S26
BS03 ZN B H57 H59 E63 H106 H57 H59 E63 H106
BS04 NLA B L25 Q46 T54 P55 H57 E63 F65 F149 W151 L25 Q46 T54 P55 H57 E63 F65 F149 W151 MOAD: Kd=0.15uM
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
GO:0010011 auxin binding
GO:0046872 metal ion binding
Biological Process
GO:0000911 cytokinesis by cell plate formation
GO:0009734 auxin-activated signaling pathway
GO:0009826 unidimensional cell growth
GO:0032877 positive regulation of DNA endoreduplication
GO:0045793 positive regulation of cell size
GO:0051781 positive regulation of cell division
Cellular Component
GO:0005783 endoplasmic reticulum
GO:0005788 endoplasmic reticulum lumen

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1lrh, PDBe:1lrh, PDBj:1lrh
PDBsum1lrh
PubMed12065401
UniProtP13689|ABP1_MAIZE Auxin-binding protein 1 (Gene Name=ABP1)

[Back to BioLiP]