Structure of PDB 1lqw Chain B |
>1lqwB (length=183) Species: 1280 (Staphylococcus aureus) [Search protein sequence] |
MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIA KRYGLRSGVGLAAPQINISKRMIAVLIPDDGSGKSYDYMLVNPKIVSHSV QEAYLPTGEGCLSVDDNVAGLVHRHNRITIKAKDIEGNDIQLRLKGYPAI VFQHEIDHLNGVMFYDHIDKNHPLQPHTDAVEV |
|
PDB | 1lqw The crystal structures of four peptide deformylases bound to the antibiotic actinonin reveal two distinct types: a platform for the structure-based design of antibacterial agents. |
Chain | B |
Resolution | 1.87 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
B |
C111 H154 H158 |
C111 H154 H158 |
|
|
|
|