Structure of PDB 1lgh Chain B

Receptor sequence
>1lghB (length=43) Species: 1083 (Magnetospirillum molischianum) [Search protein sequence]
RSLSGLTEEEAIAVHDQFKTTFSAFIILAAVAHVLVWVWKPWF
3D structure
PDB1lgh The crystal structure of the light-harvesting complex II (B800-850) from Rhodospirillum molischianum.
ChainB
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BCL B F27 A31 A34 H35 F25 A29 A32 H33
BS02 BCL B H17 F20 F24 H15 F18 F22
BS03 LYC B Q19 F24 Q17 F22
BS04 BCL B F24 F27 I28 H35 V38 W44 F45 F22 F25 I26 H33 V36 W42 F43
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1lgh, PDBe:1lgh, PDBj:1lgh
PDBsum1lgh
PubMed8736556
UniProtP95673|LHB1_MAGML Light-harvesting protein B-800/850 beta 1 chain (Gene Name=B1)

[Back to BioLiP]