Structure of PDB 1lfm Chain B |
>1lfmB (length=103) Species: 8237 (Thunnus thynnus) [Search protein sequence] |
GDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTD ANKSKGIVWNNDTLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKS ATS |
|
PDB | 1lfm Using deeply trapped intermediates to map the cytochrome c folding landscape. |
Chain | B |
Resolution | 1.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
|
|
Biological Process |
GO:0006122 |
mitochondrial electron transport, ubiquinol to cytochrome c |
GO:0006123 |
mitochondrial electron transport, cytochrome c to oxygen |
GO:0043280 |
positive regulation of cysteine-type endopeptidase activity involved in apoptotic process |
|
|