Structure of PDB 1ldq Chain B

Receptor sequence

>1ldqB (length=112) Species: 9031 (Gallus gallus)

KCSLTGKWTNDLGSNMTIGAVNSRGEFTGTYTTAESPLHGTENTINKRTQ
PTFGFTVNWKFSESTTVFTGQCFIDRNGKEVLKTMWLLRSSVNDIGDDWK
ATRVGINIFTRL

3D structure

• PDB: 1ldq Ligand exchange between proteins: exchange of biotin and biotin derivatives between avidin and streptavidin
• Chain: B
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SHM	B	S216 Y233 W270 T277 W297 N318	S14 Y31 W59 T66 W86 N107

Gene Ontology

Molecular Function

• GO:0009374 biotin binding

Biological Process

• GO:0019731 antibacterial humoral response

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:1ldq, PDBe:1ldq, PDBj:1ldq
• PDBsum: 1ldq
• PubMed: 12055191
• UniProt: P02701|AVID_CHICK Avidin (Gene Name=AVD)