Structure of PDB 1lbz Chain B

Receptor sequence

>1lbzB (length=252) Species: 2234 (Archaeoglobus fulgidus)

MDERDALRISREIAGEVRKAIASMPLRERVKDVGMGKDGTPTKAADRVAE
DAALEILRKERVTVVTEESGVLGEGDVFVALDPLDGTFNATRGIPVYSVS
LCFSYSDKLKDAFFGYVYNLATGDEYYADSSGAYRNGERIEVSDAEELYC
NAIIYYPDRKFPFKRMRIFGSAATELCFFADGSFDCFLDIRPGKMLRIYD
AAAGVFIAEKAGGKVTELDGESLGNKKFDMQERLNIVAANEKLHPKLLEL
IK

3D structure

• PDB: 1lbz Crystal structure of a dual activity IMPase/FBPase (AF2372) from Archaeoglobus fulgidus. The story of a mobile loop.
• Chain: B
• Resolution: 2.2 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E367 D382 L384 D385 T387 D500
• Catalytic site (residue number reindexed from 1): E67 D82 L84 D85 T87 D200
• Enzyme Commision number: 3.1.3.11: fructose-bisphosphatase.
  3.1.3.25: inositol-phosphate phosphatase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FBP	B	D385 G386 Y455 Y456 S471 A472	D85 G86 Y155 Y156 S171 A172
BS02	CA	B	D382 D385 D500	D82 D85 D200
BS03	CA	B	E367 D382 L384	E67 D82 L84
BS04	CA	B	T340 P341 E367	T40 P41 E67

Gene Ontology

Molecular Function

• GO:0008934 inositol monophosphate 1-phosphatase activity
• GO:0016787 hydrolase activity
• GO:0042132 fructose 1,6-bisphosphate 1-phosphatase activity
• GO:0046872 metal ion binding
• GO:0052832 inositol monophosphate 3-phosphatase activity
• GO:0052833 inositol monophosphate 4-phosphatase activity
• GO:0052834 inositol monophosphate phosphatase activity

Biological Process

• GO:0006020 inositol metabolic process
• GO:0007165 signal transduction
• GO:0046854 phosphatidylinositol phosphate biosynthetic process

External links

• PDB: RCSB:1lbz, PDBe:1lbz, PDBj:1lbz
• PDBsum: 1lbz
• PubMed: 11940584
• UniProt: O30298|BSUHB_ARCFU Fructose-1,6-bisphosphatase/inositol-1-monophosphatase (Gene Name=suhB)