Structure of PDB 1kf6 Chain B

Receptor sequence
>1kf6B (length=243) Species: 562 (Escherichia coli) [Search protein sequence]
AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPD
LSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIER
DLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCIN
CGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNG
VWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR
3D structure
PDB1kf6 Crystallographic studies of the Escherichia coli quinol-fumarate reductase with inhibitors bound to the quinol-binding site.
ChainB
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.3.5.1: succinate dehydrogenase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 FES B C57 R58 C62 G63 C65 C77 C57 R58 C62 G63 C65 C77
BS02 F3S B C158 C204 F206 V207 G208 C210 I224 C158 C204 F206 V207 G208 C210 I224
BS03 SF4 B C148 I149 N150 C151 G152 C154 C214 C148 I149 N150 C151 G152 C154 C214
BS04 HQO B T205 F206 Q225 K228 T205 F206 Q225 K228 PDBbind-CN: -logKd/Ki=6.70,Ki=0.2uM
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008177 succinate dehydrogenase (quinone) activity
GO:0009055 electron transfer activity
GO:0016491 oxidoreductase activity
GO:0046872 metal ion binding
GO:0051536 iron-sulfur cluster binding
GO:0051537 2 iron, 2 sulfur cluster binding
GO:0051538 3 iron, 4 sulfur cluster binding
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0006099 tricarboxylic acid cycle
GO:0006113 fermentation
GO:0009061 anaerobic respiration
GO:0019645 anaerobic electron transport chain
GO:0044780 bacterial-type flagellum assembly
Cellular Component
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0045283 fumarate reductase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1kf6, PDBe:1kf6, PDBj:1kf6
PDBsum1kf6
PubMed11850430
UniProtP0AC47|FRDB_ECOLI Fumarate reductase iron-sulfur subunit (Gene Name=frdB)

[Back to BioLiP]