Structure of PDB 1keb Chain B |
>1kebB (length=108) Species: 562 (Escherichia coli) [Search protein sequence] |
SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKLIASILDEIADEYQ GKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLK EFLDANLA |
|
PDB | 1keb Structural Consequences of Replacement of an alpha-helical Pro Residue in E.coli Thioredoxin |
Chain | B |
Resolution | 1.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
B |
S1 D2 |
S1 D2 |
|
|
|
|