Structure of PDB 1kb4 Chain B

Receptor sequence
>1kb4B (length=99) Species: 9606 (Homo sapiens) [Search protein sequence]
RICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTCPFNGDCRITKD
NRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSL
3D structure
PDB1kb4 Structural basis of VDR-DNA interactions on direct repeat response elements.
ChainB
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B F234 H235 F236 R249 I294 L295 F13 H14 F15 R28 I73 L74
BS02 dna B E242 G243 R250 R273 R274 R280 E21 G22 R29 R52 R53 R59
BS03 ZN B C224 C227 C241 C244 C3 C6 C20 C23
BS04 ZN B C260 C266 C276 C279 C39 C45 C55 C58
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1kb4, PDBe:1kb4, PDBj:1kb4
PDBsum1kb4
PubMed11980721
UniProtP11473|VDR_HUMAN Vitamin D3 receptor (Gene Name=VDR)

[Back to BioLiP]