Structure of PDB 1k3m Chain B

Receptor sequence

>1k3mB (length=30) Species: 9606 (Homo sapiens)

FVNQHLCGSDLVEALYLVCGERGFFYTKPT

3D structure

• PDB: 1k3m A cavity-forming mutation in insulin induces segmental unfolding of a surrounding alpha-helix.
• Chain: B
• Resolution: N/A

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	F1 N3 H5 L6 C7 G8 L11 L15 V18 C19 G23 F24	F1 N3 H5 L6 C7 G8 L11 L15 V18 C19 G23 F24

Gene Ontology

Molecular Function

• GO:0005179 hormone activity

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:1k3m, PDBe:1k3m, PDBj:1k3m
• PDBsum: 1k3m
• PubMed: 11742127
• UniProt: P01308|INS_HUMAN Insulin (Gene Name=INS)