Structure of PDB 1jqi Chain B

Receptor sequence

>1jqiB (length=384) Species: 10116 (Rattus norvegicus) [Search protein sequence]

VYQSVELPETHQMLRQTCRDFAEKELVPIAAQLDKEHLFPTSQVKKMGEL
GLLAMDVPEELSGAGLDYLAYSIALEEISRGCASTGVIMSVNNSLYLGPI
LKFGSSQQKQQWITPFTNGDKIGCFALSEPGNGSDAGAASTTAREEGDSW
VLNGTKAWITNSWEASATVVFASTDRSRQNKGISAFLVPMPTPGLTLGKK
EDKLGIRASSTANLIFEDCRIPKENLLGEPGMGFKIAMQTLDMGRIGIAS
QALGIAQASLDCAVKYAENRHAFGAPLTKLQNIQFKLADMALALESARLL
TWRAAMLKDNKKPFTKESAMAKLAASEAATAISHQAIQILGGMGYVTEMP
AERYYRDARITEIYEGTSEIQRLVIAGHLLRSYR

3D structure

PDB

1jqi Crystal structure of rat short chain acyl-CoA dehydrogenase complexed with acetoacetyl-CoA: comparison with other acyl-CoA dehydrogenases.

Chain

Resolution

2.25 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	L530 S531 G647 E768 G780
Catalytic site (residue number reindexed from 1)	L127 S128 G244 E365 G377
Enzyme Commision number	1.3.8.1: short-chain acyl-CoA dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	FAD	B	R673 F676 L680 L683 Q741 I742 G745	R270 F273 L277 L280 Q338 I339 G342
BS02	CAA	B	L498 F528 S537 F637 M641 Q642 L644 D645 R648 Y767 E768 G769	L95 F125 S134 F234 M238 Q239 L241 D242 R245 Y364 E365 G366
BS03	FAD	B	F528 L530 S531 G536 S537 W561 T563 I763 T770 E772 L776	F125 L127 S128 G133 S134 W158 T160 I360 T367 E369 L373

Gene Ontology

	Molecular Function
GO:0000062	fatty-acyl-CoA binding
GO:0003995	acyl-CoA dehydrogenase activity
GO:0016491	oxidoreductase activity
GO:0016627	oxidoreductase activity, acting on the CH-CH group of donors
GO:0016937	short-chain fatty acyl-CoA dehydrogenase activity
GO:0042802	identical protein binding
GO:0050660	flavin adenine dinucleotide binding

	Biological Process
GO:0006631	fatty acid metabolic process
GO:0006635	fatty acid beta-oxidation
GO:0033539	fatty acid beta-oxidation using acyl-CoA dehydrogenase
GO:0042594	response to starvation
GO:0046359	butyrate catabolic process
GO:0046395	carboxylic acid catabolic process
GO:0051384	response to glucocorticoid

	Cellular Component
GO:0005739	mitochondrion
GO:0005759	mitochondrial matrix
GO:0031966	mitochondrial membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1jqi, PDBe:1jqi, PDBj:1jqi
PDBsum	1jqi
PubMed	11812788
UniProt	P15651\|ACADS_RAT Short-chain specific acyl-CoA dehydrogenase, mitochondrial (Gene Name=Acads)

[Back to BioLiP]