Structure of PDB 1joc Chain B

Receptor sequence

>1jocB (length=123) Species: 9606 (Homo sapiens)

QDERRALLERCLKGEGEIEKLQTKVLELQRKLDNTTAAVQELGRENQSLQ
IKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAK
NALTPSSKKPVRVCDACFNDLQG

3D structure

• PDB: 1joc Multivalent endosome targeting by homodimeric EEA1.
• Chain: B
• Resolution: 2.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	B	C1374 C1377 C1405	C86 C89 C117
BS02	ZN	B	C1358 C1361 C1385	C70 C73 C97
BS03	ITP	B	D1352 R1370 R1371 H1372 H1373 R1375	D64 R82 R83 H84 H85 R87	MOAD: Kd=24uM PDBbind-CN: -logKd/Ki=4.62,Kd=24uM

Gene Ontology

Molecular Function

• GO:0046872 metal ion binding

External links

• PDB: RCSB:1joc, PDBe:1joc, PDBj:1joc
• PDBsum: 1joc
• PubMed: 11741531
• UniProt: Q15075|EEA1_HUMAN Early endosome antigen 1 (Gene Name=EEA1)