Structure of PDB 1jfi Chain B

Receptor sequence
>1jfiB (length=135) Species: 9606 (Homo sapiens) [Search protein sequence]
DDLTIPRAAINKMIKETLPNVRVANDARELVVNCCTEFIHLISSEANEIC
NKSEKKTISPEHVIQALESLGFGSYISEVKEVLQECKTVALKRRKASSRL
ENLGIPEEELLRQQQELFAKARQQQAELAQQEWLQ
3D structure
PDB1jfi Crystal structure of negative cofactor 2 recognizing the TBP-DNA transcription complex.
ChainB
Resolution2.62 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 dna B K164 R202 K56 R94
BS02 dna B R115 R201 R7 R93
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0016251 RNA polymerase II general transcription initiation factor activity
GO:0017025 TBP-class protein binding
GO:0046982 protein heterodimerization activity
GO:0140223 general transcription initiation factor activity
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0045995 regulation of embryonic development
GO:0051123 RNA polymerase II preinitiation complex assembly
GO:0051302 regulation of cell division
GO:0051726 regulation of cell cycle
GO:0090043 regulation of tubulin deacetylation
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0017054 negative cofactor 2 complex
GO:0072686 mitotic spindle
GO:0090575 RNA polymerase II transcription regulator complex
GO:0140672 ATAC complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1jfi, PDBe:1jfi, PDBj:1jfi
PDBsum1jfi
PubMed11461703
UniProtQ01658|NC2B_HUMAN Protein Dr1 (Gene Name=DR1)

[Back to BioLiP]