Structure of PDB 1jdz Chain B

Receptor sequence

>1jdzB (length=226) Species: 2287 (Saccharolobus solfataricus)

PVHILAKKGEVAERVLVVGDPGRARLLSTLLQNPKLTNENRGFLVYTGKY
NGETVSIATHGIGGPSIAIVLEELAMLGANVFIRYGTTGALVPYINLGEY
IIVTGASYNQGGLFYQYLRDNACVASTPDFELTNKLVTSFSKRNLKYYVG
NVFSSDAFYAEDEEFVKKWSSRGNIAVEMECATLFTLSKVKGWKSATVLV
VSDNLAEELEKSVMDGAKAVLDTLTS

3D structure

• PDB: 1jdz Three-dimensional structure of a hyperthermophilic 5'-deoxy-5'-methylthioadenosine phosphorylase from Sulfolobus solfataricus.
• Chain: B
• Resolution: 2.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H5 G21 R25 R43 E75 R86 T89 S204 D205 L207 L219
• Catalytic site (residue number reindexed from 1): H3 G19 R23 R41 E73 R84 T87 S202 D203 L205 L209
• Enzyme Commision number: 2.4.2.1: purine-nucleoside phosphorylase.
  2.4.2.28: S-methyl-5'-thioadenosine phosphorylase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SO4	B	G21 R25 R86 G88 T89	G19 R23 R84 G86 T87
BS02	FMB	B	I64 T89 T90 G91 M181 E182 D205	I62 T87 T88 G89 M179 E180 D203
BS03	FMB	B	H5 R43	H3 R41

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0016757 glycosyltransferase activity
• GO:0016763 pentosyltransferase activity
• GO:0017061 S-methyl-5-thioadenosine phosphorylase activity

Biological Process

• GO:0009116 nucleoside metabolic process
• GO:0009164 nucleoside catabolic process

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:1jdz, PDBe:1jdz, PDBj:1jdz
• PDBsum: 1jdz
• PubMed: 11489901
• UniProt: P50389|PNPH_SACS2 Purine nucleoside phosphorylase (Gene Name=SSO2706)