Structure of PDB 1ja0 Chain B

Receptor sequence
>1ja0B (length=432) Species: 10116 (Rattus norvegicus) [Search protein sequence]
IRQYELVVHEDMDVAKVYTGEMGRLKSYENQKPPFDAKNPFLAAVTANRK
LNQGTERHLMHLELDISDSKIRYESGDHVAVYPANDSALVNQIGEILGAD
LDVIMSLNNLDEESNKKHPFPCPTTYRTALTYYLDITNPPRTNVLYELAQ
YASEPSEQEHLHKMASSSGEGKELYLSWVVEARRHILAILQDYPSLRPPI
DHLCELLPRLQARYYSIASSSKVHPNSVHICAVAVEYEAKSGRVNKGVAT
SWLRAKEPAGGRALVPMFVRKSQFRLPFKSTTPVIMVGPGTGIAPFMGFI
QERAWLREQGKEVGETLLYYGCRRSDEDYLYREELARFHKDGALTQLNVA
FSREQAHKVYVQHLLKRDREHLWKLIHEGGAHIYVCGDARNMAKDVQNTF
YDIVAEFGPMEHTQAVDYVKKLMTKGRYSLDV
3D structure
PDB1ja0 NADPH-cytochrome P450 oxidoreductase. Structural basis for hydride and electron transfer.
ChainB
Resolution2.6 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) Y456 S457 C630 D675
Catalytic site (residue number reindexed from 1) Y215 S216 C386 D431
Enzyme Commision number 1.6.2.4: NADPH--hemoprotein reductase.
Interaction with ligand
Gene Ontology
Molecular Function
GO:0003958 NADPH-hemoprotein reductase activity
GO:0004128 cytochrome-b5 reductase activity, acting on NAD(P)H
GO:0008941 nitric oxide dioxygenase NAD(P)H activity
GO:0009055 electron transfer activity
GO:0010181 FMN binding
GO:0016491 oxidoreductase activity
GO:0016787 hydrolase activity
GO:0019899 enzyme binding
GO:0047726 iron-cytochrome-c reductase activity
GO:0050660 flavin adenine dinucleotide binding
GO:0050661 NADP binding
Biological Process
GO:0003420 regulation of growth plate cartilage chondrocyte proliferation
GO:0007584 response to nutrient
GO:0009410 response to xenobiotic stimulus
GO:0009437 carnitine metabolic process
GO:0009725 response to hormone
GO:0009812 flavonoid metabolic process
GO:0019395 fatty acid oxidation
GO:0022900 electron transport chain
GO:0032332 positive regulation of chondrocyte differentiation
GO:0043066 negative regulation of apoptotic process
GO:0043602 nitrate catabolic process
GO:0045542 positive regulation of cholesterol biosynthetic process
GO:0045880 positive regulation of smoothened signaling pathway
GO:0046210 nitric oxide catabolic process
GO:0070988 demethylation
GO:0071371 cellular response to gonadotropin stimulus
GO:0071372 cellular response to follicle-stimulating hormone stimulus
GO:0071375 cellular response to peptide hormone stimulus
GO:0071548 response to dexamethasone
GO:0090031 positive regulation of steroid hormone biosynthetic process
GO:0090181 regulation of cholesterol metabolic process
GO:0090346 cellular organofluorine metabolic process
Cellular Component
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005829 cytosol
GO:0016020 membrane
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ja0, PDBe:1ja0, PDBj:1ja0
PDBsum1ja0
PubMed11371558
UniProtP00388|NCPR_RAT NADPH--cytochrome P450 reductase (Gene Name=Por)

[Back to BioLiP]