Structure of PDB 1j6t Chain B

Receptor sequence
>1j6tB (length=85) Species: 562 (Escherichia coli) [Search protein sequence]
MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKL
QTLGLTQGTVVTISAEGEDEQKAVEHLVKLMAELE
3D structure
PDB1j6t Solution Structure of the Phosphoryl Transfer Complex between the Cytoplasmic A Domain of the Mannitol Transporter IImannitol and HPr of the Escherichia coli Phosphotransferase System
ChainB
ResolutionN/A
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 PO3 B H315 T316 H15 T16
Gene Ontology
Molecular Function
GO:0004857 enzyme inhibitor activity
GO:0005515 protein binding
GO:0008047 enzyme activator activity
GO:0016775 phosphotransferase activity, nitrogenous group as acceptor
GO:0030234 enzyme regulator activity
GO:0045152 antisigma factor binding
Biological Process
GO:0009401 phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0043609 regulation of carbon utilization
GO:0045819 positive regulation of glycogen catabolic process
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1j6t, PDBe:1j6t, PDBj:1j6t
PDBsum1j6t
PubMed12202490
UniProtP0AA04|PTHP_ECOLI Phosphocarrier protein HPr (Gene Name=ptsH)

[Back to BioLiP]