Structure of PDB 1j59 Chain B

Receptor sequence
>1j59B (length=197) Species: 562 (Escherichia coli) [Search protein sequence]
PTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKE
MILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQV
NPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMT
HPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVV
3D structure
PDB1j59 Structure of the CAP-DNA complex at 2.5 angstroms resolution: a complete picture of the protein-DNA interface.
ChainB
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 dna B V139 C178 E181 T182 R185 V131 C170 E173 T174 R177
BS02 dna B T168 R169 Q170 R180 T160 R161 Q162 R172
BS03 CMP B L124 S128 L116 S120
BS04 CMP B G71 L73 R82 S83 A84 G63 L65 R74 S75 A76
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003680 minor groove of adenine-thymine-rich DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0008301 DNA binding, bending
GO:0030552 cAMP binding
GO:0042802 identical protein binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0045013 carbon catabolite repression of transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005829 cytosol
GO:0032993 protein-DNA complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1j59, PDBe:1j59, PDBj:1j59
PDBsum1j59
PubMed8757802
UniProtP0ACJ8|CRP_ECOLI DNA-binding transcriptional dual regulator CRP (Gene Name=crp)

[Back to BioLiP]