Structure of PDB 1j34 Chain B |
>1j34B (length=123) Species: 88087 (Protobothrops flavoviridis) [Search protein sequence] |
DCPSDWSSYEGHCYKPFSEPKNWADAENFCTQQHAGGHLVSFQSSEEADF VVKLAFQTFGHSIFWMGLSNVWNQCNWQWSNAAMLRYKAWAEESYCVYFK STNNKWRSRACRMMAQFVCEFQA |
|
PDB | 1j34 Crystal Structure of Mg2+- and Ca2+-bound Gla Domain of Factor IX Complexed with Binding Protein |
Chain | B |
Resolution | 1.55 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
B |
S241 Q243 E247 E320 |
S41 Q43 E47 E120 |
|
|
|
|