Structure of PDB 1ixs Chain B

Receptor sequence

>1ixsB (length=315) Species: 274 (Thermus thermophilus)

LALRPKTLDEYIGQERLKQKLRVYLEAAKARKEPLEHLLLFGPPGLGKTT
LAHVIAHELGVNLRVTSGPAIEKPGDLAAILANSLEEGDILFIDEIHRLS
RQAEEHLYPAMEDFVMDIVIGQGPAARTIRLELPRFTLIGATTRPGLITA
PLLSRFGIVEHLEYYTPEELAQGVMRDARLLGVRITEEAALEIGRRSRGT
MRVAKRLFRRVRDFAQVAGEEVITRERALEALAALGLDELGLEKRDREIL
EVLILRFGGGPVGLATLATALSEDPGTLEEVHEPYLIRQGLLKRTPRGRV
ATELAYRHLGYPPPV

3D structure

• PDB: 1ixs Crystal Structure of the RuvA-RuvB Complex: A Structural Basis for the Holliday Junction Migrating Motor Machinery
• Chain: B
• Resolution: 3.2 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): K51 T52 D97 T146 R205
• Catalytic site (residue number reindexed from 1): K48 T49 D94 T143 R202
• Enzyme Commision number: 3.6.4.12: DNA helicase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ANP	B	Y14 I15 G50 K51 T52 T53 M204 R205	Y11 I12 G47 K48 T49 T50 M201 R202

Gene Ontology

Molecular Function

• GO:0000400 four-way junction DNA binding
• GO:0003677 DNA binding
• GO:0005524 ATP binding
• GO:0009378 four-way junction helicase activity
• GO:0016787 hydrolase activity
• GO:0016887 ATP hydrolysis activity

Biological Process

• GO:0006281 DNA repair
• GO:0006310 DNA recombination
• GO:0032508 DNA duplex unwinding

Cellular Component

• GO:0005737 cytoplasm
• GO:0048476 Holliday junction resolvase complex

External links

• PDB: RCSB:1ixs, PDBe:1ixs, PDBj:1ixs
• PDBsum: 1ixs
• PubMed: 12408833
• UniProt: Q5SL87|RUVB_THET8 Holliday junction branch migration complex subunit RuvB (Gene Name=ruvB)