Structure of PDB 1ijd Chain B

Receptor sequence
>1ijdB (length=40) Species: 1074 (Rhodoblastus acidophilus) [Search protein sequence]
AEVLTSEQAEELHKHVIDGTRVFLVIAAIAHFLAFTLTPW
3D structure
PDB1ijd The crystallographic structure of the B800-820 LH3 light-harvesting complex from the purple bacteria Rhodopseudomonas acidophila strain 7050.
ChainB
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BCL B F23 A27 A30 H31 F23 A27 A30 H31
BS02 BCL B I17 T20 R21 H31 I17 T20 R21 H31
BS03 RPA B L4 Q8 L12 H15 G19 T20 L4 Q8 L12 H15 G19 T20
BS04 BCL B T20 F23 L24 H31 W40 T20 F23 L24 H31 W40
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ijd, PDBe:1ijd, PDBj:1ijd
PDBsum1ijd
PubMed11467938
UniProtP35094|LHB1_RHOAC Light-harvesting protein B-800/820 beta chain

[Back to BioLiP]