Structure of PDB 1ie3 Chain B

Receptor sequence

>1ie3B (length=312) Species: 562 (Escherichia coli)

MKVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIP
TAVKIKGFSGEDATPALEGADVVLISAGVARKPGMDRSDLFNVNAGIVKN
LVQQVAKTCPKACIGIITNPVNTTVAIAAEVLKKAGVYDKNKLFGVTTLD
IICSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQVPGVSFTEQEVA
DLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEQGVVE
CAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAFEQNALEGMLDTLK
KDIALGQEFVNK

3D structure

• PDB: 1ie3 Structural Analyses of a Malate Dehydrogenase with a Variable Active Site
• Chain: B
• Resolution: 2.5 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R87 D150 H177
• Catalytic site (residue number reindexed from 1): R87 D150 H177
• Enzyme Commision number: 1.1.1.37: malate dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAD	B	G10 G11 I12 D34 I35 S76 A77 G78 I97 I117 N119 H177 M227	G10 G11 I12 D34 I35 S76 A77 G78 I97 I117 N119 H177 M227

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0016491 oxidoreductase activity
• GO:0016615 malate dehydrogenase activity
• GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
• GO:0030060 L-malate dehydrogenase (NAD+) activity
• GO:0042803 protein homodimerization activity

Biological Process

• GO:0006096 glycolytic process
• GO:0006099 tricarboxylic acid cycle
• GO:0006108 malate metabolic process
• GO:0006113 fermentation
• GO:0009061 anaerobic respiration
• GO:0019752 carboxylic acid metabolic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0016020 membrane
• GO:0019898 extrinsic component of membrane

External links

• PDB: RCSB:1ie3, PDBe:1ie3, PDBj:1ie3
• PDBsum: 1ie3
• PubMed: 11389141
• UniProt: P61889|MDH_ECOLI Malate dehydrogenase (Gene Name=mdh)