Structure of PDB 1idb Chain B

Receptor sequence

>1idbB (length=99) Species: 11709 (Human immunodeficiency virus 2)

PQFSLWKRPVVTAYIEGQPVEVLLDTGADDSIVAGIELGNNYSPKIVGGI
GGFINTKEYKNVEIEVLNKKVRATIMTGDTPINIFGRNILTALGMSLNL

3D structure

• PDB: 1idb Crystal structures of HIV-2 protease in complex with inhibitors containing the hydroxyethylamine dipeptide isostere.
• Chain: B
• Resolution: 2.2 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D25 T26 G27
• Catalytic site (residue number reindexed from 1): D25 T26 G27
• Enzyme Commision number: 2.7.7.-
  2.7.7.49: RNA-directed DNA polymerase.
  2.7.7.7: DNA-directed DNA polymerase.
  3.1.-.-
  3.1.13.2: exoribonuclease H.
  3.1.26.13: retroviral ribonuclease H.
  3.4.23.47: HIV-2 retropepsin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	0DO	B	D25 G27 A28 D29 D30 V47 G49 I50 P81 I82	D25 G27 A28 D29 D30 V47 G49 I50 P81 I82	MOAD: ic50=11nM PDBbind-CN: -logKd/Ki=7.96,IC50=11nM

Gene Ontology

Molecular Function

• GO:0004190 aspartic-type endopeptidase activity

Biological Process

• GO:0006508 proteolysis

External links

• PDB: RCSB:1idb, PDBe:1idb, PDBj:1idb
• PDBsum: 1idb
• PubMed: 7743130
• UniProt: P04584|POL_HV2RO Gag-Pol polyprotein (Gene Name=gag-pol)