Structure of PDB 1icq Chain B

Receptor sequence

>1icqB (length=351) Species: 4081 (Solanum lycopersicum)

VDKIPLMSPCKMGKFELCHRVVLAPLTRQRSYGYIPQPHAILHYSQRSTN
GGLLIGEATVISETGIGYKDVPGIWTKEQVEAWKPIVDAVHAKGGIFFCQ
IWHVGRVSNKDFQPNGEDPISCTDRGLTPQIMSNGIDIAHFTRPRRLTTD
EIPQIVNEFRVAARNAIEAGFDGVEIHGAHGYLIDQFMKDQVNDRSDKYG
GSLENRCRFALEIVEAVANEIGSDRVGIRISPFAHYNEAGDTNPTALGLY
MVESLNKYDLAYCHVVEPRESLVPMRKAYKGTFIVAGGYDREDGNRALIE
DRADLVAYGRLFISNPDLPKRFELNAPLNKYNRDTFYTSDPIVGYTDYPF
L

3D structure

• PDB: 1icq X-ray structure of 12-oxophytodienoate reductase 1 provides structural insight into substrate binding and specificity within the family of OYE.
• Chain: B
• Resolution: 2.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): T37 H187 H190 Y192 R239 N247
• Catalytic site (residue number reindexed from 1): T27 H177 H180 Y182 R229 N237
• Enzyme Commision number: 1.3.1.42: 12-oxophytodienoate reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FMN	B	P35 L36 T37 A68 Q110 H187 H190 R239 G308 G309 G330 R331 F357 Y358	P25 L26 T27 A58 Q100 H177 H180 R229 G287 G288 G309 R310 F336 Y337
BS02	OPD	B	T37 Q39 Y78 M142 S143 H187 H190 Y192 Y358	T27 Q29 Y68 M132 S133 H177 H180 Y182 Y337

Gene Ontology

Molecular Function

• GO:0010181 FMN binding
• GO:0016491 oxidoreductase activity
• GO:0016629 12-oxophytodienoate reductase activity

Biological Process

• GO:0006633 fatty acid biosynthetic process
• GO:0031408 oxylipin biosynthetic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:1icq, PDBe:1icq, PDBj:1icq
• PDBsum: 1icq
• PubMed: 11377202
• UniProt: Q9XG54|OPR1_SOLLC 12-oxophytodienoate reductase 1 (Gene Name=OPR1)