Structure of PDB 1ia3 Chain B

Receptor sequence

>1ia3B (length=192) Species: 5476 (Candida albicans)

MLKPNVAIIVAALKPALGIGYKGKMPWRLRKEIRYFKDVTTRTTKPNTRN
AVIMGRKTWESIPQKFRPLPDRLNIILSRSYENEIIDDNIIHASSIESSL
NLVSDVERVFIIGGAEIYNELINNSLVSHLLITEIEHPSPESIEMDTFLK
FPLESWTKQPKSELQKFVGDTVLEDDIKEGDFTYNYTLWTRK

3D structure

• PDB: 1ia3 X-ray Crystal Structures of Candida albicans Dihydrofolate Reductase: High Resolution Ternary Complexes in Which the Dihydronicotinamide Moiety of NADPH is Displaced by an inhibitor
• Chain: B
• Resolution: 1.78 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): M25 W27 E32 I33 F36 L69 V109 T133
• Catalytic site (residue number reindexed from 1): M25 W27 E32 I33 F36 L69 V109 T133
• Enzyme Commision number: 1.5.1.3: dihydrofolate reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NDP	B	G55 R56 K57 T58 L77 S78 R79 S94 I96 G114 A115 E116 I117 E120	G55 R56 K57 T58 L77 S78 R79 S94 I96 G114 A115 E116 I117 E120
BS02	TQ5	B	I9 V10 I19 E32 F36 T58 I112	I9 V10 I19 E32 F36 T58 I112	MOAD: ic50=8nM BindingDB: IC50=8nM

Gene Ontology

Molecular Function

• GO:0004146 dihydrofolate reductase activity
• GO:0016491 oxidoreductase activity
• GO:0050661 NADP binding

Biological Process

• GO:0006730 one-carbon metabolic process
• GO:0046452 dihydrofolate metabolic process
• GO:0046654 tetrahydrofolate biosynthetic process
• GO:0046655 folic acid metabolic process

Cellular Component

• GO:0005739 mitochondrion

External links

• PDB: RCSB:1ia3, PDBe:1ia3, PDBj:1ia3
• PDBsum: 1ia3
• PubMed: 11520201
• UniProt: P22906|DYR_CANAX Dihydrofolate reductase (Gene Name=DFR1)