Structure of PDB 1i7a Chain B |
>1i7aB (length=103) Species: 10090 (Mus musculus) [Search protein sequence] |
EQPIFTTRAHVFQINWVPASKQAVTVSYFYDVTRNSYRIISVDGAKVIIN STITPNMTFTKTSQKFGQWADSRANTVFGLGFSSELQLTKFAEKFQEVRE AAR |
|
PDB | 1i7a The N-terminal domain of Homer/Vesl is a new class II EVH1 domain. |
Chain | B |
Resolution | 2.24 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
B |
S71 K73 F74 |
S63 K65 F66 |
|
|
|
|