Structure of PDB 1i72 Chain B |
>1i72B (length=61) Species: 9606 (Homo sapiens) [Search protein sequence] |
AHFFEGTEKLLEVWFSRQQPQGSGDLRTIPRSEWDILLKDVQCSIISVTK TDKQEAYVLSE |
|
PDB | 1i72 The structural basis for substrate specificity and inhibition of human S-adenosylmethionine decarboxylase. |
Chain | B |
Resolution | 2.0 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
E67 |
Catalytic site (residue number reindexed from 1) |
E61 |
Enzyme Commision number |
4.1.1.50: adenosylmethionine decarboxylase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MAO |
B |
F7 L65 S66 E67 |
F4 L59 S60 E61 |
PDBbind-CN: -logKd/Ki=7.26,IC50=55nM BindingDB: IC50=55nM |
|
|
|