Structure of PDB 1i6u Chain B

Receptor sequence
>1i6uB (length=127) Species: 2190 (Methanocaldococcus jannaschii) [Search protein sequence]
MDPLANALNHISNCERVGKKVVYIKPASKLIGRVLKVMQDNGYIGEFEFI
EDGRAGIFKVELIGKINKCGAIKPRFPVKKFGYEKFEKRYLPARDFGILI
VSTTQGVMSHEEAKKRGLGGRLLAYVY
3D structure
PDB1i6u Detailed analysis of RNA-protein interactions within the ribosomal protein S8-rRNA complex from the archaeon Methanococcus jannaschii.
ChainB
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B F84 E87 K118 F81 E84 K115
BS02 rna B S31 K32 R36 A58 R78 P80 K82 K83 S105 T106 T107 G120 G122 R124 S28 K29 R33 A55 R75 P77 K79 K80 S102 T103 T104 G117 G119 R121
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1i6u, PDBe:1i6u, PDBj:1i6u
PDBsum1i6u
PubMed11478863
UniProtP54041|RS8_METJA Small ribosomal subunit protein uS8 (Gene Name=rps8)

[Back to BioLiP]