Structure of PDB 1i53 Chain B |
>1i53B (length=128) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] |
AQCSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVL STAADMQGVVTDGMASGLDKDYLKPDDSRVIAQTKLIGSGEKDSVTFDVS KLKEGEHYMFFCTFPGHSALMKGTLTLK |
|
PDB | 1i53 Properties of photogenerated tryptophan and tyrosyl radicals in structurally characterized proteins containing rhenium(I) tricarbonyl diimines. |
Chain | B |
Resolution | 1.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
B |
H46 C112 H117 |
H46 C112 H117 |
|
|
|
|