Structure of PDB 1hze Chain B |
>1hzeB (length=97) Species: 562 (Escherichia coli) [Search protein sequence] |
MFTGIVQGTAKLVSIDEKPNFRTHVVELPDHMLDGLETGASVAHNGCCLT VTEINGNHVSFDLMKETLRITNLGDLKVGDWVNVERAAKFSDEIGGH |
|
PDB | 1hze The solution structure of the N-terminal domain of riboflavin synthase. |
Chain | B |
Resolution | N/A |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
RBF |
B |
C48 L49 D62 T67 |
C48 L49 D62 T67 |
|
|
|