Structure of PDB 1hlz Chain B

Receptor sequence
>1hlzB (length=81) Species: 9606 (Homo sapiens) [Search protein sequence]
GMVLLCKVCGDVASGFHYGVLACEGCKGFFRRSIQQNIQYKRCLKNENCS
IVRINRNRCQQCRFKKCLSVGMSRDAVRFGR
3D structure
PDB1hlz DNA Deformability as a Recognition Feature in the RevErb Response Element
ChainB
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B G10 F11 H12 Y13 K22 R26 V71 F73 R75 G15 F16 H17 Y18 K27 R31 V77 F79 R81
BS02 dna B E19 G20 R27 R50 N51 Q54 R57 R75 E24 G25 R32 R56 N57 Q60 R63 R81
BS03 ZN B C1 C4 C18 C21 C6 C9 C23 C26
BS04 ZN B C37 C43 C53 C43 C49 C59
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1hlz, PDBe:1hlz, PDBj:1hlz
PDBsum1hlz
PubMed11669620
UniProtP20393|NR1D1_HUMAN Nuclear receptor subfamily 1 group D member 1 (Gene Name=NR1D1)

[Back to BioLiP]