Structure of PDB 1hlc Chain B

Receptor sequence

>1hlcB (length=129) Species: 9606 (Homo sapiens)

ELEVKNMDMKPGSTLKITGSIADGTDGFVINLGQGTDKLNLHFNPRFSES
TIVCNSLDGSNWGQEQREDHLCFSPGSEVKFTVTFESDKFKVKLPDGHEL
TFPNRLGHSHLSYLSVRGGFNMSSFKLKE

3D structure

• PDB: 1hlc X-ray crystal structure of the human dimeric S-Lac lectin, L-14-II, in complex with lactose at 2.9-A resolution.
• Chain: B
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BGC	B	R49 E68 R70	R46 E65 R67
BS02	GAL	B	H45 R49 N58 W65	H42 R46 N55 W62

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0016936 galactoside binding
• GO:0030246 carbohydrate binding

Biological Process

• GO:0043029 T cell homeostasis
• GO:0043065 positive regulation of apoptotic process
• GO:0050729 positive regulation of inflammatory response
• GO:0098609 cell-cell adhesion

Cellular Component

• GO:1990724 galectin complex

External links

• PDB: RCSB:1hlc, PDBe:1hlc, PDBj:1hlc
• PDBsum: 1hlc
• PubMed: 8262940
• UniProt: P05162|LEG2_HUMAN Galectin-2 (Gene Name=LGALS2)