Structure of PDB 1hds Chain B

Receptor sequence

>1hdsB (length=145) Species: 9874 (Odocoileus virginianus)

MLTAEEKAAVTGFWGKVDVDVVGAQALGRLLVVYPWTQRFFQHFGNLSSA
GAVMNNPKVKAHGKRVLDAFTQGLKHLDDLKGAFAQLSGLHCNKLHVNPQ
NFRLLGNVLALVVARNFGGQFTPNVQALFQKVVAGVANALAHKYH

3D structure

• PDB: 1hds Molecular packing and intermolecular contacts of sickling deer type III hemoglobin.
• Chain: B
• Resolution: 1.98 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	B	F40 H43 H62 R65 F84 L87 H91 L95 V97 N101 F102	F40 H43 H62 R65 F84 L87 H91 L95 V97 N101 F102

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0031721 hemoglobin alpha binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex
• GO:0072562 blood microparticle

External links

• PDB: RCSB:1hds, PDBe:1hds, PDBj:1hds
• PDBsum: 1hds
• UniProt: P02074|HBB_ODOVI Hemoglobin subunit beta-3 (Gene Name=HBB)