Structure of PDB 1hcq Chain B

Receptor sequence
>1hcqB (length=71) Species: 9606 (Homo sapiens) [Search protein sequence]
TRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDK
NRRKSCQACRLRKCYEVGMMK
3D structure
PDB1hcq The crystal structure of the estrogen receptor DNA-binding domain bound to DNA: how receptors discriminate between their response elements.
ChainB
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B E25 R33 R56 K57 Q60 R63 E22 R30 R53 K54 Q57 R60
BS02 dna B G16 Y17 H18 Y19 K28 K32 G13 Y14 H15 Y16 K25 K29
BS03 ZN B C7 C10 C24 C27 C4 C7 C21 C24
BS04 ZN B C43 C49 C59 C62 C40 C46 C56 C59
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1hcq, PDBe:1hcq, PDBj:1hcq
PDBsum1hcq
PubMed8221895
UniProtP03372|ESR1_HUMAN Estrogen receptor (Gene Name=ESR1)

[Back to BioLiP]